![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (16 species) not a true protein |
![]() | Species Babesia bovis [TaxId:484906] [232542] (1 PDB entry) |
![]() | Domain d3i3rb1: 3i3r B:5-187 [232546] Other proteins in same PDB: d3i3ra2, d3i3rb2 automated match to d2oipa1 complexed with cl |
PDB Entry: 3i3r (more details), 2.35 Å
SCOPe Domain Sequences for d3i3rb1:
Sequence, based on SEQRES records: (download)
>d3i3rb1 c.71.1.0 (B:5-187) automated matches {Babesia bovis [TaxId: 484906]} yegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvi fgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilg gsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviy erk
>d3i3rb1 c.71.1.0 (B:5-187) automated matches {Babesia bovis [TaxId: 484906]} yegcgdltifvavalnkvighknqipwphithdfrflrngttyipppdiqnvvifgrkty elknrinvilsrtvkevpgclvyedlstairdlranvphnkifilggsflykevldnglc dkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviyerk
Timeline for d3i3rb1: