![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) ![]() automatically mapped to Pfam PF00303 |
![]() | Family d.117.1.0: automated matches [227244] (1 protein) not a true family |
![]() | Protein automated matches [227010] (5 species) not a true protein |
![]() | Species Babesia bovis [TaxId:484906] [232544] (3 PDB entries) |
![]() | Domain d3i3ra2: 3i3r A:205-510 [232545] Other proteins in same PDB: d3i3ra1, d3i3rb1 automated match to d1qzfa2 complexed with cl |
PDB Entry: 3i3r (more details), 2.35 Å
SCOPe Domain Sequences for d3i3ra2:
Sequence, based on SEQRES records: (download)
>d3i3ra2 d.117.1.0 (A:205-510) automated matches {Babesia bovis [TaxId: 484906]} gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp ipmams
>d3i3ra2 d.117.1.0 (A:205-510) automated matches {Babesia bovis [TaxId: 484906]} gtdiskpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfdls rsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdree hdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsdlk kmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglgef vhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshppip mams
Timeline for d3i3ra2: