Lineage for d3i2ga1 (3i2g A:2-351)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901210Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)
  6. 2901259Protein automated matches [232528] (2 species)
    not a true protein
  7. 2901260Species Rhodococcus sp. [TaxId:104109] [232529] (10 PDB entries)
  8. 2901269Domain d3i2ga1: 3i2g A:2-351 [232535]
    Other proteins in same PDB: d3i2ga2, d3i2ga3
    automated match to d1ju3a2
    complexed with cl, dbc, gol, so4; mutant

Details for d3i2ga1

PDB Entry: 3i2g (more details), 2.5 Å

PDB Description: cocaine esterase with mutation g173q, bound to dtt adduct
PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3i2ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i2ga1 c.69.1.21 (A:2-351) automated matches {Rhodococcus sp. [TaxId: 104109]}
vdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwle
fvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgv
tqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtqlitsrsda
rpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislf
erlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgi
aatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw

SCOPe Domain Coordinates for d3i2ga1:

Click to download the PDB-style file with coordinates for d3i2ga1.
(The format of our PDB-style files is described here.)

Timeline for d3i2ga1: