Lineage for d3hz2a_ (3hz2 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304495Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 1304496Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 1304607Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 1304608Protein automated matches [191109] (6 species)
    not a true protein
  7. 1304656Species Methanosarcina acetivorans [TaxId:2214] [232522] (1 PDB entry)
  8. 1304657Domain d3hz2a_: 3hz2 A: [232525]
    automated match to d1ha4a_
    complexed with ca

Details for d3hz2a_

PDB Entry: 3hz2 (more details), 1.86 Å

PDB Description: crystal structure of a betagamma-crystallin from an archaea
PDB Compounds: (A:) Beta/gama crystallin family protein

SCOPe Domain Sequences for d3hz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hz2a_ b.11.1.0 (A:) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

SCOPe Domain Coordinates for d3hz2a_:

Click to download the PDB-style file with coordinates for d3hz2a_.
(The format of our PDB-style files is described here.)

Timeline for d3hz2a_: