Class b: All beta proteins [48724] (174 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
Protein automated matches [191109] (6 species) not a true protein |
Species Methanosarcina acetivorans [TaxId:2214] [232522] (1 PDB entry) |
Domain d3hz2a_: 3hz2 A: [232525] automated match to d1ha4a_ complexed with ca |
PDB Entry: 3hz2 (more details), 1.86 Å
SCOPe Domain Sequences for d3hz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hz2a_ b.11.1.0 (A:) automated matches {Methanosarcina acetivorans [TaxId: 2214]} naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl gpgeyssvesagipdnsissfrqi
Timeline for d3hz2a_: