| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
| Protein automated matches [191109] (11 species) not a true protein |
| Species Methanosarcina acetivorans [TaxId:2214] [232522] (3 PDB entries) |
| Domain d3hz2b_: 3hz2 B: [232523] automated match to d1ha4a_ complexed with ca |
PDB Entry: 3hz2 (more details), 1.86 Å
SCOPe Domain Sequences for d3hz2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hz2b_ b.11.1.0 (B:) automated matches {Methanosarcina acetivorans [TaxId: 2214]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi
Timeline for d3hz2b_: