Lineage for d1qscc1 (1qsc C:350-501)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776288Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776289Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1776290Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 1776306Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 1776307Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 1776346Domain d1qscc1: 1qsc C:350-501 [23252]
    Other proteins in same PDB: d1qsca2, d1qscb2, d1qscc2

Details for d1qscc1

PDB Entry: 1qsc (more details), 2.4 Å

PDB Description: crystal structure of the traf domain of traf2 in a complex with a peptide from the cd40 receptor
PDB Compounds: (C:) tnf receptor associated factor 2

SCOPe Domain Sequences for d1qscc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qscc1 b.8.1.1 (C:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1qscc1:

Click to download the PDB-style file with coordinates for d1qscc1.
(The format of our PDB-style files is described here.)

Timeline for d1qscc1: