SCOPe 2.07: Domain d3hv1a1: 3hv1 A:27-283

Lineage for d3hv1a1 (3hv1 A:27-283)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Streptococcus thermophilus [TaxId:264199] [232515] (1 PDB entry)

8. Domain d3hv1a1: 3hv1 A:27-283 [232516]
   Other proteins in same PDB: d3hv1a2, d3hv1b2
   automated match to d2pvua_

Details for d3hv1a1

PDB Entry: 3hv1, 1.9 Å

PDB Description: crystal structure of a polar amino acid abc uptake transporter substrate binding protein from streptococcus thermophilus

PDB Compounds: (A:) Polar amino acid ABC uptake transporter substrate binding protein

SCOPe Domain Sequences for d3hv1a1:

Sequence; same for both SEQRES and ATOM records:

>d3hv1a1 c.94.1.0 (A:27-283) automated matches {Streptococcus thermophilus [TaxId: 264199]}
rshfatqkdqwqtytkekkikigfdatfvpmgyeekdgsyigfdidlanavfklygidve
wqaidwdmketelkngtidliwngysvtderkqsadftepymvneqvlvtkkssgidsva
gmagktlgaqagssgydafnaspkilkdvvanqkvvqystftqalidlnsgridgllidr
vyanyyleksgvldqynvmpagyegesfavgarkvdktlikkinqgfetlykngefqkis
nkwfgedvatdqvkgkr

Timeline for d3hv1a1:

• d3hv1a1 first appeared in SCOPe 2.03, called d3hv1a_
  
• d3hv1a1 appears in SCOPe 2.06
  
• d3hv1a1 appears in the current release, SCOPe 2.08