Lineage for d3htza2 (3htz A:237-453)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349425Fold a.203: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101352] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2349426Superfamily a.203.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101353] (1 family) (S)
  5. 2349427Family a.203.1.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101354] (1 protein)
  6. 2349428Protein Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101355] (1 species)
  7. 2349429Species Aquifex aeolicus [TaxId:63363] [101356] (6 PDB entries)
  8. 2349437Domain d3htza2: 3htz A:237-453 [232514]
    Other proteins in same PDB: d3htza1, d3htza3
    automated match to d1riqa1
    protein/RNA complex

Details for d3htza2

PDB Entry: 3htz (more details), 2.5 Å

PDB Description: Crystal Structure of the catalytic fragment of alanyl-tRNA synthetase in complex with L-serine: Re-refined
PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d3htza2:

Sequence, based on SEQRES records: (download)

>d3htza2 a.203.1.1 (A:237-453) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhfkveakkvkpvyshlkelgktsafvg

Sequence, based on observed residues (ATOM records): (download)

>d3htza2 a.203.1.1 (A:237-453) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkpvyshlkelgktsafvg

SCOPe Domain Coordinates for d3htza2:

Click to download the PDB-style file with coordinates for d3htza2.
(The format of our PDB-style files is described here.)

Timeline for d3htza2: