Lineage for d3huma2 (3hum A:316-382)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409301Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2409302Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 2409323Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein)
    rudiment form of the PBP-5-like domain
    automatically mapped to Pfam PF09211
  6. 2409324Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species)
  7. 2409325Species Staphylococcus aureus [TaxId:1280] [110100] (3 PDB entries)
    Uniprot Q53613 21-383
  8. 2409330Domain d3huma2: 3hum A:316-382 [232513]
    Other proteins in same PDB: d3huma1, d3humb1
    automated match to d1tvfa1
    complexed with cew

Details for d3huma2

PDB Entry: 3hum (more details), 2.3 Å

PDB Description: crystal structure of penicillin binding protein 4 from staphylococcus aureus col in complex with cefotaxime
PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3huma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huma2 b.105.1.2 (A:316-382) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevh

SCOPe Domain Coordinates for d3huma2:

Click to download the PDB-style file with coordinates for d3huma2.
(The format of our PDB-style files is described here.)

Timeline for d3huma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3huma1