![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [111288] (3 PDB entries) Uniprot Q53613 21-383 |
![]() | Domain d3huma1: 3hum A:25-315 [232510] Other proteins in same PDB: d3huma2, d3humb2 automated match to d1tvfa2 complexed with cew |
PDB Entry: 3hum (more details), 2.3 Å
SCOPe Domain Sequences for d3huma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3huma1 e.3.1.1 (A:25-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvtt ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy
Timeline for d3huma1: