Lineage for d3huma1 (3hum A:25-315)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013471Protein Pencillin binding protein 4 (PbpD), N-terminal domain [111287] (1 species)
  7. 3013472Species Staphylococcus aureus [TaxId:1280] [111288] (3 PDB entries)
    Uniprot Q53613 21-383
  8. 3013477Domain d3huma1: 3hum A:25-315 [232510]
    Other proteins in same PDB: d3huma2, d3humb2
    automated match to d1tvfa2
    complexed with cew

Details for d3huma1

PDB Entry: 3hum (more details), 2.3 Å

PDB Description: crystal structure of penicillin binding protein 4 from staphylococcus aureus col in complex with cefotaxime
PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3huma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huma1 e.3.1.1 (A:25-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

SCOPe Domain Coordinates for d3huma1:

Click to download the PDB-style file with coordinates for d3huma1.
(The format of our PDB-style files is described here.)

Timeline for d3huma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3huma2