Lineage for d1qscb1 (1qsc B:350-501)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369911Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 369912Superfamily b.8.1: TRAF domain-like [49599] (2 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 369913Family b.8.1.1: TRAF domain [49600] (3 proteins)
  6. 369914Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 369915Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 369953Domain d1qscb1: 1qsc B:350-501 [23251]
    Other proteins in same PDB: d1qsca2, d1qscb2, d1qscc2

Details for d1qscb1

PDB Entry: 1qsc (more details), 2.4 Å

PDB Description: crystal structure of the traf domain of traf2 in a complex with a peptide from the cd40 receptor

SCOP Domain Sequences for d1qscb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qscb1 b.8.1.1 (B:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOP Domain Coordinates for d1qscb1:

Click to download the PDB-style file with coordinates for d1qscb1.
(The format of our PDB-style files is described here.)

Timeline for d1qscb1: