SCOPe 2.04: Domain d3htza1: 3htz A:1-236

Lineage for d3htza1 (3htz A:1-236)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries)

8. Domain d3htza1: 3htz A:1-236 [232509]
   Other proteins in same PDB: d3htza2
   automated match to d1riqa2
   protein/RNA complex

Details for d3htza1

PDB Entry: 3htz, 2.5 Å

PDB Description: Crystal Structure of the catalytic fragment of alanyl-tRNA synthetase in complex with L-serine: Re-refined

PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d3htza1:

Sequence; same for both SEQRES and ATOM records:

>d3htza1 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

Timeline for d3htza1:

• d3htza1 first appeared in SCOPe 2.03
  
• d3htza1 appears in SCOPe 2.05
  
• d3htza1 appears in the current release, SCOPe 2.08