![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
![]() | Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
![]() | Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
![]() | Protein automated matches [191061] (8 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [232418] (5 PDB entries) |
![]() | Domain d3hqja_: 3hqj A: [232504] automated match to d3nfde_ complexed with coa, mg |
PDB Entry: 3hqj (more details), 1.95 Å
SCOPe Domain Sequences for d3hqja_:
Sequence, based on SEQRES records: (download)
>d3hqja_ d.150.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} givgvgidlvsipdfaeqvdqpgtvfmetftpgerrdasdksssaarhlaarwaakeavi kawsgsrfaqrpmlpedihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdta aavaileap
>d3hqja_ d.150.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} givgvgidlvsipdfaeqvdtftpgerrdassaarhlaarwaakeavikawsgsrfaqrp mihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdtaaavaileap
Timeline for d3hqja_: