Lineage for d3hqja_ (3hqj A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676137Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1676138Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1676171Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 1676172Protein automated matches [191061] (8 species)
    not a true protein
  7. 1676202Species Mycobacterium tuberculosis [TaxId:1773] [232418] (5 PDB entries)
  8. 1676204Domain d3hqja_: 3hqj A: [232504]
    automated match to d3nfde_
    complexed with coa, mg

Details for d3hqja_

PDB Entry: 3hqj (more details), 1.95 Å

PDB Description: structure-function analysis of mycobacterium tuberculosis acyl carrier protein synthase (acps).
PDB Compounds: (A:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3hqja_:

Sequence, based on SEQRES records: (download)

>d3hqja_ d.150.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
givgvgidlvsipdfaeqvdqpgtvfmetftpgerrdasdksssaarhlaarwaakeavi
kawsgsrfaqrpmlpedihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdta
aavaileap

Sequence, based on observed residues (ATOM records): (download)

>d3hqja_ d.150.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
givgvgidlvsipdfaeqvdtftpgerrdassaarhlaarwaakeavikawsgsrfaqrp
mihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdtaaavaileap

SCOPe Domain Coordinates for d3hqja_:

Click to download the PDB-style file with coordinates for d3hqja_.
(The format of our PDB-style files is described here.)

Timeline for d3hqja_: