Lineage for d3hp0b_ (3hp0 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354733Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1354734Protein automated matches [190246] (42 species)
    not a true protein
  7. 1354756Species Bacillus subtilis [TaxId:1423] [232498] (1 PDB entry)
  8. 1354758Domain d3hp0b_: 3hp0 B: [232500]
    automated match to d3mybb_

Details for d3hp0b_

PDB Entry: 3hp0 (more details), 2.32 Å

PDB Description: Crystal structure of a Putative polyketide biosynthesis enoyl-CoA hydratase (pksH) from Bacillus subtilis
PDB Compounds: (B:) Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH

SCOPe Domain Sequences for d3hp0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hp0b_ c.14.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
iiryvetgqfp

SCOPe Domain Coordinates for d3hp0b_:

Click to download the PDB-style file with coordinates for d3hp0b_.
(The format of our PDB-style files is described here.)

Timeline for d3hp0b_: