| Class b: All beta proteins [48724] (180 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
| Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
| Protein automated matches [229100] (6 species) not a true protein |
| Species Clostridium tetani [TaxId:1513] [232493] (3 PDB entries) |
| Domain d3hn1a2: 3hn1 A:1111-1315 [232496] Other proteins in same PDB: d3hn1a1 automated match to d1a8da2 complexed with gla, so4 |
PDB Entry: 3hn1 (more details), 2.1 Å
SCOPe Domain Sequences for d3hn1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hn1a2 b.42.4.2 (A:1111-1315) automated matches {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd
Timeline for d3hn1a2: