SCOPe 2.05: Domain d3hmya2: 3hmy A:1111-1315

Lineage for d3hmya2 (3hmy A:1111-1315)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein automated matches [229100] (3 species)
   not a true protein

7. Species Clostridium tetani [TaxId:1513] [232493] (2 PDB entries)

8. Domain d3hmya2: 3hmy A:1111-1315 [232494]
   Other proteins in same PDB: d3hmya1
   automated match to d1a8da2
   complexed with gol, so4

Details for d3hmya2

PDB Entry: 3hmy, 2 Å

PDB Description: crystal structure of hcr/t complexed with gt2

PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d3hmya2:

Sequence; same for both SEQRES and ATOM records:

>d3hmya2 b.42.4.2 (A:1111-1315) automated matches {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

Timeline for d3hmya2:

• d3hmya2 first appeared in SCOPe 2.03
  
• d3hmya2 appears in SCOPe 2.04
  
• d3hmya2 appears in SCOPe 2.06
  
• d3hmya2 appears in the current release, SCOPe 2.08