Class b: All beta proteins [48724] (176 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
Protein automated matches [229100] (3 species) not a true protein |
Species Clostridium tetani [TaxId:1513] [232493] (2 PDB entries) |
Domain d3hmya2: 3hmy A:1111-1315 [232494] Other proteins in same PDB: d3hmya1 automated match to d1a8da2 complexed with gol, so4 |
PDB Entry: 3hmy (more details), 2 Å
SCOPe Domain Sequences for d3hmya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hmya2 b.42.4.2 (A:1111-1315) automated matches {Clostridium tetani [TaxId: 1513]} itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy fnhlkdkilgcdwyfvptdegwtnd
Timeline for d3hmya2: