Lineage for d3hmya1 (3hmy A:866-1110)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043490Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 protein domains)
    automatically mapped to Pfam PF07953
  6. 2043528Protein automated matches [229097] (4 species)
    not a true protein
  7. 2043536Species Clostridium tetani [TaxId:1513] [232491] (2 PDB entries)
  8. 2043537Domain d3hmya1: 3hmy A:866-1110 [232492]
    Other proteins in same PDB: d3hmya2
    automated match to d1a8da1
    complexed with gol, so4

Details for d3hmya1

PDB Entry: 3hmy (more details), 2 Å

PDB Description: Crystal structure of HCR/T complexed with GT2
PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d3hmya1:

Sequence, based on SEQRES records: (download)

>d3hmya1 b.29.1.6 (A:866-1110) automated matches {Clostridium tetani [TaxId: 1513]}
nldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihl
vnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhsl
sigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssan
lyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekly
tsyls

Sequence, based on observed residues (ATOM records): (download)

>d3hmya1 b.29.1.6 (A:866-1110) automated matches {Clostridium tetani [TaxId: 1513]}
nldcwedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnne
ssevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmksigsgwsv
slkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlm
gsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

SCOPe Domain Coordinates for d3hmya1:

Click to download the PDB-style file with coordinates for d3hmya1.
(The format of our PDB-style files is described here.)

Timeline for d3hmya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hmya2