SCOPe 2.03: Domain d3hmeb_: 3hme B:

Lineage for d3hmeb_ (3hme B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (145 PDB entries)

8. Domain d3hmeb_: 3hme B: [232487]
   automated match to d4nqna_

Details for d3hmeb_

PDB Entry: 3hme, 2.23 Å

PDB Description: Crystal structure of human bromodomain containing 9 isoform 1 (BRD9)

PDB Compounds: (B:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d3hmeb_:

Sequence; same for both SEQRES and ATOM records:

>d3hmeb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
estpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyk
svtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

Timeline for d3hmeb_:

• d3hmeb_ is new in SCOPe 2.03-stable
  
• d3hmeb_ appears in SCOPe 2.04
  
• d3hmeb_ appears in the current release, SCOPe 2.08