SCOPe 2.04: Domain d3hmea_: 3hme A:

Lineage for d3hmea_ (3hme A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)

8. Domain d3hmea_: 3hme A: [232486]
   automated match to d4nqna_

Details for d3hmea_

PDB Entry: 3hme, 2.23 Å

PDB Description: Crystal structure of human bromodomain containing 9 isoform 1 (BRD9)

PDB Compounds: (A:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d3hmea_:

Sequence; same for both SEQRES and ATOM records:

>d3hmea_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

Timeline for d3hmea_:

• d3hmea_ first appeared in SCOPe 2.03
  
• d3hmea_ appears in SCOPe 2.05
  
• d3hmea_ appears in the current release, SCOPe 2.08