Lineage for d3hmea_ (3hme A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707780Domain d3hmea_: 3hme A: [232486]
    automated match to d4nqna_

Details for d3hmea_

PDB Entry: 3hme (more details), 2.23 Å

PDB Description: Crystal structure of human bromodomain containing 9 isoform 1 (BRD9)
PDB Compounds: (A:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d3hmea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmea_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

SCOPe Domain Coordinates for d3hmea_:

Click to download the PDB-style file with coordinates for d3hmea_.
(The format of our PDB-style files is described here.)

Timeline for d3hmea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hmeb_