SCOPe 2.05: Domain d1ca9e1: 1ca9 E:350-501

Lineage for d1ca9e1 (1ca9 E:350-501)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)

8. Domain d1ca9e1: 1ca9 E:350-501 [23248]
   Other proteins in same PDB: d1ca9a2, d1ca9b2, d1ca9c2, d1ca9d2, d1ca9e2, d1ca9f2

Details for d1ca9e1

PDB Entry: 1ca9, 2.3 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a peptide from tnf-r2

PDB Compounds: (E:) protein (tnf receptor associated factor 2)

SCOPe Domain Sequences for d1ca9e1:

Sequence; same for both SEQRES and ATOM records:

>d1ca9e1 b.8.1.1 (E:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

Timeline for d1ca9e1:

• d1ca9e1 first appeared (with stable ids) in SCOP 1.55
  
• d1ca9e1 appears in SCOPe 2.04
  
• d1ca9e1 appears in SCOPe 2.06
  
• d1ca9e1 appears in the current release, SCOPe 2.08