Lineage for d3hihb2 (3hih B:495-593)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446678Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 1446679Superfamily d.223.1: Polo-box domain [82615] (2 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 1446685Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 1446686Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 1446692Species Human (Homo sapiens) [TaxId:9606] [102858] (16 PDB entries)
  8. 1446702Domain d3hihb2: 3hih B:495-593 [232477]
    automated match to d3hiha2
    complexed with edo, gol, so4

Details for d3hihb2

PDB Entry: 3hih (more details), 1.7 Å

PDB Description: Structure of human Plk1-PBD with glycerol and sulfate in the phophopeptide binding site
PDB Compounds: (B:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d3hihb2:

Sequence, based on SEQRES records: (download)

>d3hihb2 d.223.1.2 (B:495-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
anitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyid
ekrdfrtyrlslleeygcckelasrlryartmvdkllss

Sequence, based on observed residues (ATOM records): (download)

>d3hihb2 d.223.1.2 (B:495-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
anirarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrt
yrlslleeygcckelasrlryartmvdkllss

SCOPe Domain Coordinates for d3hihb2:

Click to download the PDB-style file with coordinates for d3hihb2.
(The format of our PDB-style files is described here.)

Timeline for d3hihb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hihb1