| Class b: All beta proteins [48724] (174 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.1: MATH domain [49600] (4 proteins) automatically mapped to Pfam PF00917 |
| Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries) |
| Domain d1ca9d1: 1ca9 D:350-501 [23247] Other proteins in same PDB: d1ca9a2, d1ca9b2, d1ca9c2, d1ca9d2, d1ca9e2, d1ca9f2 |
PDB Entry: 1ca9 (more details), 2.3 Å
SCOPe Domain Sequences for d1ca9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ca9d1 b.8.1.1 (D:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl
Timeline for d1ca9d1: