Lineage for d1ca9d1 (1ca9 D:350-501)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458529Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 458530Superfamily b.8.1: TRAF domain-like [49599] (2 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 458531Family b.8.1.1: TRAF domain [49600] (3 proteins)
  6. 458532Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 458533Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 458567Domain d1ca9d1: 1ca9 D:350-501 [23247]
    Other proteins in same PDB: d1ca9a2, d1ca9b2, d1ca9c2, d1ca9d2, d1ca9e2, d1ca9f2

Details for d1ca9d1

PDB Entry: 1ca9 (more details), 2.3 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a peptide from tnf-r2

SCOP Domain Sequences for d1ca9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca9d1 b.8.1.1 (D:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOP Domain Coordinates for d1ca9d1:

Click to download the PDB-style file with coordinates for d1ca9d1.
(The format of our PDB-style files is described here.)

Timeline for d1ca9d1: