Lineage for d3hg0c2 (3hg0 C:63-163)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048683Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 2048700Protein automated matches [232461] (1 species)
    not a true protein
  7. 2048701Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)
  8. 2048709Domain d3hg0c2: 3hg0 C:63-163 [232465]
    Other proteins in same PDB: d3hg0a2, d3hg0c1, d3hg0d1, d3hg0d2
    automated match to d2f0ca1

Details for d3hg0c2

PDB Entry: 3hg0 (more details), 2.1 Å

PDB Description: Crystal structure of a DARPin in complex with ORF49 from Lactococcal phage TP901-1
PDB Compounds: (C:) Baseplate protein

SCOPe Domain Sequences for d3hg0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hg0c2 b.21.1.3 (C:63-163) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

SCOPe Domain Coordinates for d3hg0c2:

Click to download the PDB-style file with coordinates for d3hg0c2.
(The format of our PDB-style files is described here.)

Timeline for d3hg0c2: