SCOPe 2.03: Domain d3hg0b1: 3hg0 B:63-163

Lineage for d3hg0b1 (3hg0 B:63-163)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
   automatically mapped to Pfam PF08932

6. Protein automated matches [232461] (1 species)
   not a true protein

7. Species Lactococcus phage [TaxId:35345] [232462] (2 PDB entries)

8. Domain d3hg0b1: 3hg0 B:63-163 [232463]
   Other proteins in same PDB: d3hg0c1, d3hg0d_
   automated match to d2f0ca1

Details for d3hg0b1

PDB Entry: 3hg0, 2.1 Å

PDB Description: Crystal structure of a DARPin in complex with ORF49 from Lactococcal phage TP901-1

PDB Compounds: (B:) Baseplate protein

SCOPe Domain Sequences for d3hg0b1:

Sequence; same for both SEQRES and ATOM records:

>d3hg0b1 b.21.1.3 (B:63-163) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

Timeline for d3hg0b1:

• d3hg0b1 is new in SCOPe 2.03-stable
  
• d3hg0b1 appears in SCOPe 2.04
  
• d3hg0b1 appears in the current release, SCOPe 2.08