Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Geobacter metallireducens [TaxId:269799] [232459] (2 PDB entries) |
Domain d3hdca1: 3hdc A:22-168 [232460] Other proteins in same PDB: d3hdca2, d3hdca3 automated match to d4nmua_ |
PDB Entry: 3hdc (more details), 1.77 Å
SCOPe Domain Sequences for d3hdca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdca1 c.47.1.0 (A:22-168) automated matches {Geobacter metallireducens [TaxId: 269799]} apgkaesdaplvrtgalapnfklptlsgenkslaqyrgkivlvnfwaswcpycrdempsm drlvksfpkgdlvvlavnvekrfpekyrrapvsfnflsdatgqvqqryganrlpdtfivd rkgiirqrvtggiewdapkvvsylksl
Timeline for d3hdca1: