Lineage for d3hbaa_ (3hba A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140522Species Shewanella denitrificans [TaxId:318161] [232451] (1 PDB entry)
  8. 2140523Domain d3hbaa_: 3hba A: [232452]
    automated match to d3fj1a_
    complexed with cit, gol

Details for d3hbaa_

PDB Entry: 3hba (more details), 2 Å

PDB Description: crystal structure of a putative phosphosugar isomerase (sden_2705) from shewanella denitrificans os217 at 2.00 a resolution
PDB Compounds: (A:) putative phosphosugar isomerase

SCOPe Domain Sequences for d3hbaa_:

Sequence, based on SEQRES records: (download)

>d3hbaa_ c.80.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]}
mttntimeqeartapqkiaeqllandaiteslgsvlrefkpkfvmivgrgssdhagvfak
ylfeieasiptfaaapsvasvygktlklagglvivisqsgrspdilaqarmaknagafcv
alvndetapikdivdvviplrageekavaatksylatlsallqvaakwtqneslveavns
lpqalqaavdaepqlragsltdvknlvvlgrgfgyavskeialklkevcaihaeafssae
flhgpvtlvekklsildvcirdesygshveqianvkqrganlihlhqtsadihpriapla
llqrfyidvaavaialginpdk

Sequence, based on observed residues (ATOM records): (download)

>d3hbaa_ c.80.1.0 (A:) automated matches {Shewanella denitrificans [TaxId: 318161]}
mttntimeqeartapqkiaeqllandaiteslgsvlrefkpkfvmivgrgssdhagvfak
ylfeieasiptfaaapsvasvygktlklagglvivisqsgrspdilaqarmaknagafcv
alvndetapikdivdvviplrageekavaatksylatlsallqvaakwtqneslveavns
lpqalqaavdaepqlragsltdvknlvvlgrgfgyavskeialklkevcaihaeafssae
flsildvcirdesygshveqianvkqrganlihlhqtsadihpriaplallqrfyidvaa
vaialginpdk

SCOPe Domain Coordinates for d3hbaa_:

Click to download the PDB-style file with coordinates for d3hbaa_.
(The format of our PDB-style files is described here.)

Timeline for d3hbaa_: