Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families) |
Family d.52.9.0: automated matches [232441] (1 protein) not a true family |
Protein automated matches [232442] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [232443] (1 PDB entry) |
Domain d3h90d2: 3h90 D:209-290 [232450] Other proteins in same PDB: d3h90a1, d3h90b1, d3h90c1, d3h90d1 automated match to d2qfia1 complexed with hg, zn |
PDB Entry: 3h90 (more details), 2.9 Å
SCOPe Domain Sequences for d3h90d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h90d2 d.52.9.0 (D:209-290) automated matches {Escherichia coli K-12 [TaxId: 83333]} alpdeerqeiidivtswpgvsgahdlrtrqsgptrfiqihlemedslplvqahmvadqve qailrrfpgsdviihqdpcsvv
Timeline for d3h90d2: