Lineage for d3h90d2 (3h90 D:209-290)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190902Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2191147Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families) (S)
  5. 2191158Family d.52.9.0: automated matches [232441] (1 protein)
    not a true family
  6. 2191159Protein automated matches [232442] (1 species)
    not a true protein
  7. 2191160Species Escherichia coli K-12 [TaxId:83333] [232443] (1 PDB entry)
  8. 2191164Domain d3h90d2: 3h90 D:209-290 [232450]
    Other proteins in same PDB: d3h90a1, d3h90b1, d3h90c1, d3h90d1
    automated match to d2qfia1
    complexed with hg, zn

Details for d3h90d2

PDB Entry: 3h90 (more details), 2.9 Å

PDB Description: Structural basis for the autoregulation of the zinc transporter YiiP
PDB Compounds: (D:) Ferrous-iron efflux pump fieF

SCOPe Domain Sequences for d3h90d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h90d2 d.52.9.0 (D:209-290) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alpdeerqeiidivtswpgvsgahdlrtrqsgptrfiqihlemedslplvqahmvadqve
qailrrfpgsdviihqdpcsvv

SCOPe Domain Coordinates for d3h90d2:

Click to download the PDB-style file with coordinates for d3h90d2.
(The format of our PDB-style files is described here.)

Timeline for d3h90d2: