Lineage for d3h90d1 (3h90 D:8-208)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029083Fold f.59: Cation efflux protein transmembrane domain-like [161110] (1 superfamily)
    6 transmembrane helices, bundle
  4. 3029084Superfamily f.59.1: Cation efflux protein transmembrane domain-like [161111] (1 family) (S)
  5. 3029085Family f.59.1.1: Cation efflux protein transmembrane domain-like [161112] (2 proteins)
    N-terminal part of Pfam PF01545
  6. 3029090Protein automated matches [232436] (1 species)
    not a true protein
  7. 3029091Species Escherichia coli K-12 [TaxId:83333] [232437] (1 PDB entry)
  8. 3029095Domain d3h90d1: 3h90 D:8-208 [232446]
    Other proteins in same PDB: d3h90a2, d3h90b2, d3h90c2, d3h90d2
    automated match to d2qfia2
    complexed with hg, zn

Details for d3h90d1

PDB Entry: 3h90 (more details), 2.9 Å

PDB Description: Structural basis for the autoregulation of the zinc transporter YiiP
PDB Compounds: (D:) Ferrous-iron efflux pump fieF

SCOPe Domain Sequences for d3h90d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h90d1 f.59.1.1 (D:8-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvsraaiaatamasllllikifawwytgsvsilaalvdslvdigasltnllvvryslqpa
ddnhsfghgkaeslaalaqsmfisgsalflfltgiqhlisptpmtdpgvgvivtivalic
tiilvsfqrwvvrrtqsqavradmlhyqsdvmmngaillalglswygwhradalfalgig
iyilysalrmgyeavqslldr

SCOPe Domain Coordinates for d3h90d1:

Click to download the PDB-style file with coordinates for d3h90d1.
(The format of our PDB-style files is described here.)

Timeline for d3h90d1: