| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.59: Cation efflux protein transmembrane domain-like [161110] (1 superfamily) 6 transmembrane helices, bundle |
Superfamily f.59.1: Cation efflux protein transmembrane domain-like [161111] (1 family) ![]() |
| Family f.59.1.1: Cation efflux protein transmembrane domain-like [161112] (2 proteins) N-terminal part of Pfam PF01545 |
| Protein automated matches [232436] (1 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [232437] (1 PDB entry) |
| Domain d3h90b1: 3h90 B:8-208 [232445] Other proteins in same PDB: d3h90a2, d3h90b2, d3h90c2, d3h90d2 automated match to d2qfia2 complexed with hg, zn |
PDB Entry: 3h90 (more details), 2.9 Å
SCOPe Domain Sequences for d3h90b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h90b1 f.59.1.1 (B:8-208) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvsraaiaatamasllllikifawwytgsvsilaalvdslvdigasltnllvvryslqpa
ddnhsfghgkaeslaalaqsmfisgsalflfltgiqhlisptpmtdpgvgvivtivalic
tiilvsfqrwvvrrtqsqavradmlhyqsdvmmngaillalglswygwhradalfalgig
iyilysalrmgyeavqslldr
Timeline for d3h90b1: