SCOPe 2.08: Domain d3h90a2: 3h90 A:209-290

Lineage for d3h90a2 (3h90 A:209-290)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.9: Cation efflux protein cytoplasmic domain-like [160240] (2 families)

5. Family d.52.9.0: automated matches [232441] (1 protein)
   not a true family

6. Protein automated matches [232442] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [232443] (1 PDB entry)

8. Domain d3h90a2: 3h90 A:209-290 [232444]
   Other proteins in same PDB: d3h90a1, d3h90b1, d3h90c1, d3h90d1
   automated match to d2qfia1
   complexed with hg, zn

Details for d3h90a2

PDB Entry: 3h90, 2.9 Å

PDB Description: Structural basis for the autoregulation of the zinc transporter YiiP

PDB Compounds: (A:) Ferrous-iron efflux pump fieF

SCOPe Domain Sequences for d3h90a2:

Sequence; same for both SEQRES and ATOM records:

>d3h90a2 d.52.9.0 (A:209-290) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alpdeerqeiidivtswpgvsgahdlrtrqsgptrfiqihlemedslplvqahmvadqve
qailrrfpgsdviihqdpcsvv

Timeline for d3h90a2:

• d3h90a2 first appeared in SCOPe 2.03
  
• d3h90a2 appears in SCOPe 2.07