Lineage for d3h8sa2 (3h8s A:183-305)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272685Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 1272686Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 1272710Protein T4 RNase H [47809] (1 species)
  7. 1272711Species Bacteriophage T4 [TaxId:10665] [47810] (5 PDB entries)
  8. 1272715Domain d3h8sa2: 3h8s A:183-305 [232438]
    Other proteins in same PDB: d3h8sa1
    automated match to d1tfra1
    complexed with mg

Details for d3h8sa2

PDB Entry: 3h8s (more details), 2.51 Å

PDB Description: structure of d19n t4 rnase h in the presence of divalent magnesium
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3h8sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h8sa2 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef

SCOPe Domain Coordinates for d3h8sa2:

Click to download the PDB-style file with coordinates for d3h8sa2.
(The format of our PDB-style files is described here.)

Timeline for d3h8sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h8sa1