SCOPe 2.07: Domain d3h8sa1: 3h8s A:11-180

Lineage for d3h8sa1 (3h8s A:11-180)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein T4 RNase H [53046] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries)

8. Domain d3h8sa1: 3h8s A:11-180 [232435]
   Other proteins in same PDB: d3h8sa2
   automated match to d1tfra2
   complexed with mg

Details for d3h8sa1

PDB Entry: 3h8s, 2.51 Å

PDB Description: structure of d19n t4 rnase h in the presence of divalent magnesium

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3h8sa1:

Sequence, based on SEQRES records:

>d3h8sa1 c.120.1.2 (A:11-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
ykegiclinfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlci
dnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkye
addhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Sequence, based on observed residues (ATOM records):

>d3h8sa1 c.120.1.2 (A:11-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
ykegiclinfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlci
dnaksgywrrdfayyykktwdwegyfesshkvidelkaympyivmdidkyeaddhiavlv
kkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Timeline for d3h8sa1:

• d3h8sa1 first appeared in SCOPe 2.03
  
• d3h8sa1 appears in SCOPe 2.06
  
• d3h8sa1 appears in the current release, SCOPe 2.08