SCOPe 2.06: Domain d3h8na1: 3h8n A:6-103

Lineage for d3h8na1 (3h8n A:6-103)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)

8. Domain d3h8na1: 3h8n A:6-103 [232434]
   automated match to d1b6ua1

Details for d3h8na1

PDB Entry: 3h8n, 2.5 Å

PDB Description: crystal structure analysis of kir2ds4

PDB Compounds: (A:) Killer cell immunoglobulin-like receptor 2DS4

SCOPe Domain Sequences for d3h8na1:

Sequence; same for both SEQRES and ATOM records:

>d3h8na1 b.1.1.4 (A:6-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkpsflalpghlvkseetvilqcwsdvmfehfllhregkfnntlhligehhdgvskanfs
igpmmpvlagtyrcygsvphspyqlsapsdpldmviig

Timeline for d3h8na1:

• d3h8na1 first appeared in SCOPe 2.03
  
• d3h8na1 appears in SCOPe 2.05
  
• d3h8na1 appears in SCOPe 2.07
  
• d3h8na1 appears in the current release, SCOPe 2.08