Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187072] (42 PDB entries) |
Domain d3h89d_: 3h89 D: [232425] automated match to d2xu3a_ complexed with nsx |
PDB Entry: 3h89 (more details), 2.5 Å
SCOPe Domain Sequences for d3h89d_:
Sequence, based on SEQRES records: (download)
>d3h89d_ d.3.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
>d3h89d_ d.3.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv knswgeewgmggyvkmakdrrnhcgiasaasyptv
Timeline for d3h89d_: