Lineage for d1ca4e1 (1ca4 E:350-501)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. Domain d1ca4e1: 1ca4 E:350-501 [23242]
    Other proteins in same PDB: d1ca4a2, d1ca4b2, d1ca4c2, d1ca4d2, d1ca4e2, d1ca4f2

Details for d1ca4e1

PDB Entry: 1ca4 (more details), 2.2 Å

PDB Description: structure of tnf receptor associated factor 2 (traf2)
PDB Compounds: (E:) protein (tnf receptor associated factor 2)

SCOPe Domain Sequences for d1ca4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca4e1 b.8.1.1 (E:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1ca4e1 are not available.

Timeline for d1ca4e1:

Domains from same chain:
(mouse over for more information)
d1ca4e2
Domains from other chains:
(mouse over for more information)
d1ca4a1, d1ca4a2, d1ca4b1, d1ca4b2, d1ca4c1, d1ca4c2, d1ca4d1, d1ca4d2, d1ca4f1, d1ca4f2