SCOPe 2.08: Domain d3h7qa1: 3h7q A:1-130

Lineage for d3h7qa1 (3h7q A:1-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232418] (5 PDB entries)

8. Domain d3h7qa1: 3h7q A:1-130 [232419]
   Other proteins in same PDB: d3h7qa2
   automated match to d3nfdc_
   complexed with bcn

Details for d3h7qa1

PDB Entry: 3h7q, 2.25 Å

PDB Description: Crystal structure of the holo-[Acyl-Carrier-Protein] Synthase (ACPS) from Mycobacterium tuberculosis

PDB Compounds: (A:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3h7qa1:

Sequence, based on SEQRES records:

>d3h7qa1 d.150.1.0 (A:1-130) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mgivgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaakeav
ikawsgsrfaqrpvlpedihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdt
aaavaileap

Sequence, based on observed residues (ATOM records):

>d3h7qa1 d.150.1.0 (A:1-130) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mgivgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaakeav
ikawsgsrfaihrdievvtrprvrltgaiaeyladvtihvslthegdtaaavaileap

Timeline for d3h7qa1:

• d3h7qa1 first appeared in SCOPe 2.03, called d3h7qa_
  
• d3h7qa1 appears in SCOPe 2.07