Lineage for d3h7ia2 (3h7i A:181-305)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716189Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2716190Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2716215Protein T4 RNase H [47809] (1 species)
  7. 2716216Species Bacteriophage T4 [TaxId:10665] [47810] (6 PDB entries)
  8. 2716217Domain d3h7ia2: 3h7i A:181-305 [232417]
    Other proteins in same PDB: d3h7ia1
    automated match to d1tfra1
    complexed with so4

Details for d3h7ia2

PDB Entry: 3h7i (more details), 1.5 Å

PDB Description: structure of the metal-free d132n t4 rnase h
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3h7ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h7ia2 a.60.7.1 (A:181-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
ksgsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqak
vllteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltn
sinef

SCOPe Domain Coordinates for d3h7ia2:

Click to download the PDB-style file with coordinates for d3h7ia2.
(The format of our PDB-style files is described here.)

Timeline for d3h7ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h7ia1