Lineage for d3h7ia1 (3h7i A:4-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921920Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2921945Protein T4 RNase H [53046] (1 species)
  7. 2921946Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries)
  8. 2921947Domain d3h7ia1: 3h7i A:4-180 [232416]
    Other proteins in same PDB: d3h7ia2
    automated match to d1tfra2
    complexed with so4

Details for d3h7ia1

PDB Entry: 3h7i (more details), 1.5 Å

PDB Description: structure of the metal-free d132n t4 rnase h
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3h7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h7ia1 c.120.1.2 (A:4-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
emmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgy
tkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyiv
mdidkyeandhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

SCOPe Domain Coordinates for d3h7ia1:

Click to download the PDB-style file with coordinates for d3h7ia1.
(The format of our PDB-style files is described here.)

Timeline for d3h7ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h7ia2