| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
| Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
| Protein T4 RNase H [53046] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries) |
| Domain d3h7ia1: 3h7i A:4-180 [232416] Other proteins in same PDB: d3h7ia2 automated match to d1tfra2 complexed with so4 |
PDB Entry: 3h7i (more details), 1.5 Å
SCOPe Domain Sequences for d3h7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h7ia1 c.120.1.2 (A:4-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
emmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgy
tkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyiv
mdidkyeandhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
Timeline for d3h7ia1: