Lineage for d3h7fa_ (3h7f A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381233Species Mycobacterium tuberculosis [TaxId:1773] [225404] (11 PDB entries)
  8. 1381234Domain d3h7fa_: 3h7f A: [232415]
    automated match to d3ecda_
    complexed with mg

Details for d3h7fa_

PDB Entry: 3h7f (more details), 1.5 Å

PDB Description: crystal structure of serine hydroxymethyltransferase from mycobacterium tuberculosis
PDB Compounds: (A:) Serine hydroxymethyltransferase 1

SCOPe Domain Sequences for d3h7fa_:

Sequence, based on SEQRES records: (download)

>d3h7fa_ c.67.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gsmsaplaevdpdiaellakelgrqrdtlemiasenfvpravlqaqgsvltnkyaeglpg
rryyggcehvdvvenlardrakalfgaefanvqphsgaqanaavlhalmspgerllgldl
angghlthgmrlnfsgklyengfygvdpathlidmdavratalefrpkviiagwsayprv
ldfaafrsiadevgakllvdmahfaglvaaglhpspvphadvvsttvhktlgggrsgliv
gkqqyakainsavfpgqqggplmhviagkavalkiaatpefadrqrrtlsgariiadrlm
apdvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhevgitvnrnavpndprppmv
tsglrigtpalatrgfgdteftevadiiatalatgssvdvsalkdratrlarafplydgl
eewslvg

Sequence, based on observed residues (ATOM records): (download)

>d3h7fa_ c.67.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gsmsaplaevdpdiaellakelgrqrdtlemiasenfvpravlqaqgsvltnkyaeglpg
rryyggcehvdvvenlardrakalfgaefanvqphsgaqanaavlhalmspgerllgldl
angghlthgmrlnfsgklyengfygvdpathlidmdavratalefrpkviiagwsayprv
ldfaafrsiadevgakllvdmahfaglvaaglhpspvphadvvsttvhktlgggrsgliv
gkqqyakainsavfpgqqggplmhviagkavalkiaatpefadrqrrtlsgariiadrlm
apdvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhevgitvnrsglrigtpalat
rgfgdteftevadiiatalatgssvdvsalkdratrlarafplydgleewslvg

SCOPe Domain Coordinates for d3h7fa_:

Click to download the PDB-style file with coordinates for d3h7fa_.
(The format of our PDB-style files is described here.)

Timeline for d3h7fa_:

  • d3h7fa_ appears in periodic updates to SCOPe 2.03 starting on 2014-01-11
  • d3h7fa_ appears in SCOPe 2.04
  • d3h7fa_ appears in the current release, SCOPe 2.07, called d3h7fa1