SCOPe 2.04: Domain d3h3ba1: 3h3b A:0-165

Lineage for d3h3ba1 (3h3b A:0-165)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.5: L domain [52071] (6 proteins)

6. Protein automated matches [232361] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232384] (3 PDB entries)

8. Domain d3h3ba1: 3h3b A:0-165 [232413]
   Other proteins in same PDB: d3h3ba2, d3h3bb2, d3h3bc1, d3h3bc2, d3h3bd1, d3h3bd2
   automated match to d1n8zc1

Details for d3h3ba1

PDB Entry: 3h3b, 2.45 Å

PDB Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d3h3ba1:

Sequence; same for both SEQRES and ATOM records:

>d3h3ba1 c.10.2.5 (A:0-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Timeline for d3h3ba1:

• d3h3ba1 first appeared in SCOPe 2.03
  
• d3h3ba1 appears in SCOPe 2.05
  
• d3h3ba1 appears in the current release, SCOPe 2.07