SCOPe 2.07: Domain d3h3ua2: 3h3u A:145-224

Lineage for d3h3ua2 (3h3u A:145-224)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [232395] (4 PDB entries)

8. Domain d3h3ua2: 3h3u A:145-224 [232405]
   Other proteins in same PDB: d3h3ua1, d3h3ub1
   automated match to d3r6sd2
   complexed with cmp, so4

Details for d3h3ua2

PDB Entry: 3h3u, 2.9 Å

PDB Description: Crystal structure of CRP (cAMP receptor Protein) from Mycobacterium tuberculosis

PDB Compounds: (A:) probable transcriptional regulatory protein (probably crp/fnr-family)

SCOPe Domain Sequences for d3h3ua2:

Sequence; same for both SEQRES and ATOM records:

>d3h3ua2 a.4.5.0 (A:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarrar

Timeline for d3h3ua2:

• d3h3ua2 first appeared in SCOPe 2.03
  
• d3h3ua2 appears in SCOPe 2.06
  
• d3h3ua2 appears in the current release, SCOPe 2.08