SCOPe 2.06: Domain d3h4ec2: 3h4e C:148-219

Lineage for d3h4ec2 (3h4e C:148-219)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (10 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232387] (4 PDB entries)

8. Domain d3h4ec2: 3h4e C:148-219 [232403]
   Other proteins in same PDB: d3h4ea1, d3h4eb1, d3h4ec1, d3h4ed1, d3h4ee1, d3h4ef1, d3h4eg1, d3h4eh1, d3h4ei1, d3h4ej1, d3h4ek1, d3h4el1
   automated match to d1e6jp1

Details for d3h4ec2

PDB Entry: 3h4e, 2.7 Å

PDB Description: x-ray structure of hexameric hiv-1 ca

PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d3h4ec2:

Sequence; same for both SEQRES and ATOM records:

>d3h4ec2 a.28.3.0 (C:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Timeline for d3h4ec2:

• d3h4ec2 first appeared in SCOPe 2.03
  
• d3h4ec2 appears in SCOPe 2.05
  
• d3h4ec2 appears in SCOPe 2.07
  
• d3h4ec2 appears in the current release, SCOPe 2.08