Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [232395] (3 PDB entries) |
Domain d3h3ub2: 3h3u B:145-214 [232399] Other proteins in same PDB: d3h3ua1, d3h3ub1 automated match to d3r6sd2 complexed with cmp, so4 |
PDB Entry: 3h3u (more details), 2.9 Å
SCOPe Domain Sequences for d3h3ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3ub2 a.4.5.0 (B:145-214) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi rlegksvlis
Timeline for d3h3ub2: