Lineage for d3h3ub2 (3h3u B:145-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694938Species Mycobacterium tuberculosis [TaxId:83332] [232395] (4 PDB entries)
  8. 2694940Domain d3h3ub2: 3h3u B:145-214 [232399]
    Other proteins in same PDB: d3h3ua1, d3h3ub1
    automated match to d3r6sd2
    complexed with cmp, so4

Details for d3h3ub2

PDB Entry: 3h3u (more details), 2.9 Å

PDB Description: Crystal structure of CRP (cAMP receptor Protein) from Mycobacterium tuberculosis
PDB Compounds: (B:) probable transcriptional regulatory protein (probably crp/fnr-family)

SCOPe Domain Sequences for d3h3ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3ub2 a.4.5.0 (B:145-214) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlis

SCOPe Domain Coordinates for d3h3ub2:

Click to download the PDB-style file with coordinates for d3h3ub2.
(The format of our PDB-style files is described here.)

Timeline for d3h3ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h3ub1