SCOPe 2.08: Domain d1f3vb1: 1f3v B:350-501

Lineage for d1f3vb1 (1f3v B:350-501)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)

8. Domain d1f3vb1: 1f3v B:350-501 [23237]
   Other proteins in same PDB: d1f3va_, d1f3vb2

Details for d1f3vb1

PDB Entry: 1f3v, 2 Å

PDB Description: crystal structure of the complex between the n-terminal domain of tradd and the traf domain of traf2

PDB Compounds: (B:) tumor necrosis factor receptor-associated protein

SCOPe Domain Sequences for d1f3vb1:

Sequence; same for both SEQRES and ATOM records:

>d1f3vb1 b.8.1.1 (B:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

Timeline for d1f3vb1:

• d1f3vb1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3vb1 appears in SCOPe 2.07