![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
![]() | Family a.118.1.8: Pumilio repeat [63611] (2 proteins) this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain |
![]() | Protein automated matches [191057] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [232363] (1 PDB entry) |
![]() | Domain d3h3dx1: 3h3d X:2-311 [232364] Other proteins in same PDB: d3h3dx2, d3h3dx3, d3h3dy2 automated match to d1ib2a_ |
PDB Entry: 3h3d (more details), 2.3 Å
SCOPe Domain Sequences for d3h3dx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3dx1 a.118.1.8 (X:2-311) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} srlledfrnqrypnlqlrdlanhivefsqdqhgsrfiqqklerataaekqmvfseilaaa yslmtdvfgnyviqkffefgtpeqkntlgmqvkghvlqlalqmygcrviqkalesispeq qqeivheldghvlkcvkdqngnhvvqkciecvdpvalqfiinafkgqvyslsthpygcrv iqrilehctaeqttpildelhehteqliqdqygnyviqhvlehgkqedksilinsvrgkv lvlsqhkfasnvvekcvthatrgertglidevctfndnalhvmmkdqyanyvvqkmidvs eptqlkklmt
Timeline for d3h3dx1: