SCOPe 2.03: Domain d3h3dx_: 3h3d X:

Lineage for d3h3dx_ (3h3d X:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
   this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain

6. Protein automated matches [191057] (3 species)
   not a true protein

7. Species Drosophila melanogaster [TaxId:7227] [232363] (1 PDB entry)

8. Domain d3h3dx_: 3h3d X: [232364]
   automated match to d1ib2a_

Details for d3h3dx_

PDB Entry: 3h3d, 2.3 Å

PDB Description: drosophila pumilio rna binding domain (puf domain)

PDB Compounds: (X:) Maternal protein pumilio

SCOPe Domain Sequences for d3h3dx_:

Sequence; same for both SEQRES and ATOM records:

>d3h3dx_ a.118.1.8 (X:) automated matches {Drosophila melanogaster [TaxId: 7227]}
msrlledfrnqrypnlqlrdlanhivefsqdqhgsrfiqqklerataaekqmvfseilaa
ayslmtdvfgnyviqkffefgtpeqkntlgmqvkghvlqlalqmygcrviqkalesispe
qqqeivheldghvlkcvkdqngnhvvqkciecvdpvalqfiinafkgqvyslsthpygcr
viqrilehctaeqttpildelhehteqliqdqygnyviqhvlehgkqedksilinsvrgk
vlvlsqhkfasnvvekcvthatrgertglidevctfndnalhvmmkdqyanyvvqkmidv
septqlkklmtki

Timeline for d3h3dx_:

• d3h3dx_ is new in SCOPe 2.03-stable
  
• d3h3dx_ appears in SCOPe 2.04
  
• d3h3dx_ appears in the current release, SCOPe 2.08, called d3h3dx1