Lineage for d3h3dx1 (3h3d X:2-311)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006652Family a.118.1.8: Pumilio repeat [63611] (2 protein domains)
  6. 2006678Protein automated matches [191057] (3 species)
    not a true protein
  7. 2006679Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [232363] (1 PDB entry)
  8. 2006680Domain d3h3dx1: 3h3d X:2-311 [232364]
    Other proteins in same PDB: d3h3dx2, d3h3dx3, d3h3dy2
    automated match to d1ib2a_

Details for d3h3dx1

PDB Entry: 3h3d (more details), 2.3 Å

PDB Description: Drosophila Pumilio RNA binding domain (Puf domain)
PDB Compounds: (X:) Maternal protein pumilio

SCOPe Domain Sequences for d3h3dx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3dx1 a.118.1.8 (X:2-311) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
srlledfrnqrypnlqlrdlanhivefsqdqhgsrfiqqklerataaekqmvfseilaaa
yslmtdvfgnyviqkffefgtpeqkntlgmqvkghvlqlalqmygcrviqkalesispeq
qqeivheldghvlkcvkdqngnhvvqkciecvdpvalqfiinafkgqvyslsthpygcrv
iqrilehctaeqttpildelhehteqliqdqygnyviqhvlehgkqedksilinsvrgkv
lvlsqhkfasnvvekcvthatrgertglidevctfndnalhvmmkdqyanyvvqkmidvs
eptqlkklmt

SCOPe Domain Coordinates for d3h3dx1:

Click to download the PDB-style file with coordinates for d3h3dx1.
(The format of our PDB-style files is described here.)

Timeline for d3h3dx1: