SCOPe 2.08: Domain d3h3dx1: 3h3d X:2-311

Lineage for d3h3dx1 (3h3d X:2-311)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
   this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain

6. Protein automated matches [191057] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [232363] (1 PDB entry)

8. Domain d3h3dx1: 3h3d X:2-311 [232364]
   Other proteins in same PDB: d3h3dx2, d3h3dx3, d3h3dy2
   automated match to d1ib2a_

Details for d3h3dx1

PDB Entry: 3h3d, 2.3 Å

PDB Description: drosophila pumilio rna binding domain (puf domain)

PDB Compounds: (X:) Maternal protein pumilio

SCOPe Domain Sequences for d3h3dx1:

Sequence; same for both SEQRES and ATOM records:

>d3h3dx1 a.118.1.8 (X:2-311) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
srlledfrnqrypnlqlrdlanhivefsqdqhgsrfiqqklerataaekqmvfseilaaa
yslmtdvfgnyviqkffefgtpeqkntlgmqvkghvlqlalqmygcrviqkalesispeq
qqeivheldghvlkcvkdqngnhvvqkciecvdpvalqfiinafkgqvyslsthpygcrv
iqrilehctaeqttpildelhehteqliqdqygnyviqhvlehgkqedksilinsvrgkv
lvlsqhkfasnvvekcvthatrgertglidevctfndnalhvmmkdqyanyvvqkmidvs
eptqlkklmt

Timeline for d3h3dx1:

• d3h3dx1 first appeared in SCOPe 2.03, called d3h3dx_
  
• d3h3dx1 appears in SCOPe 2.07